PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.I3G54
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 97aa    MW: 10913.5 Da    PI: 10.8637
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.I3G54genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.11.3e-304596253
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                 prlrWtp+LH rF++av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ Y
  Araip.I3G54 45 PRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQVY 96
                 8*************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-274196IPR009057Homeodomain-like
PROSITE profilePS5129413.1294197IPR017930Myb domain
SuperFamilySSF466893.4E-144396IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-224596IPR006447Myb domain, plants
PfamPF002493.7E-104696IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MDQNKQYKNN NGGGGGCSSN STVEENNEKK SSSTSVRPYV RSKLPRLRWT PDLHLRFIHA  60
VQRLGGQERA TPKLVLQLMN IKGLSIAHVK SHLQVYI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016198754.11e-60PREDICTED: transcription factor LUX-like isoform X1
RefseqXP_016198755.11e-60PREDICTED: transcription factor LUX-like isoform X2
SwissprotQ700D91e-28MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLG7KSC87e-45G7KSC8_MEDTR; MYB-like transcription factor family protein
STRINGVIT_08s0058g00250.t011e-42(Vitis vinifera)
STRINGGLYMA01G31044.14e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-34G2-like family protein